PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK36115.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 216aa    MW: 25150.3 Da    PI: 8.778
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK36115.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.7e-19552148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l+++++++G g+W++ a+  g++Rt+k+c++rw++yl
       KFK36115.1  5 RGPWTVEEDMKLINYIALHGEGRWNSLANSAGLNRTGKSCRLRWLNYL 52
                     89********************************************97 PP

2Myb_DNA-binding44.92.7e-1458101146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg  + +E+ ++++++ ++G++ W++Ia++++ gRt++++k++w++
       KFK36115.1  58 RGDISLQEQFIILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 101
                      5666889***************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.033156IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-22255IPR009057Homeodomain-like
SuperFamilySSF466893.11E-31299IPR009057Homeodomain-like
SMARTSM007174.0E-16454IPR001005SANT/Myb domain
PfamPF002498.2E-18552IPR001005SANT/Myb domain
CDDcd001671.23E-11752No hitNo description
Gene3DG3DSA:1.10.10.604.0E-2156105IPR009057Homeodomain-like
SMARTSM007171.8E-1257105IPR001005SANT/Myb domain
PROSITE profilePS5129415.76557107IPR017930Myb domain
PfamPF002493.8E-1358101IPR001005SANT/Myb domain
CDDcd001679.61E-962101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MELRRGPWTV EEDMKLINYI ALHGEGRWNS LANSAGLNRT GKSCRLRWLN YLRPDIRRGD  60
ISLQEQFIIL ELHSRWGNRW SKIAQYLPGR TDNEIKNYWR TRVQKHAKLL KCDVNSKQFK  120
DTMKHLWMPR LVERIASSQN VEITPNRYSP YENSTVTTAT SSTSSESMRS SIYGGDQMEY  180
GTLDHMTNCG GSTLFNDGDL SENLWSVDEL NNWLLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-2629924120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006393501.11e-125hypothetical protein EUTSA_v10012051mg
RefseqXP_010461601.11e-125PREDICTED: myb-related protein 340
SwissprotQ9LDE14e-78MY108_ARATH; Transcription factor MYB108
TrEMBLA0A087H1W31e-161A0A087H1W3_ARAAL; Uncharacterized protein
STRINGAT1G48000.11e-119(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.11e-118myb domain protein 112